PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC018406.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family YABBY
Protein Properties Length: 65aa    MW: 7167.62 Da    PI: 8.7897
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC018406.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY48.14.6e-151392462
         YABBY 24 vsvPstslfkvvtvrCGhCtsllsvnlakasqllaaesh 62
                  vsvP +slfk+vtvrCGhCt+llsvn++      a  ++
  EcC018406.10  1 VSVPCSSLFKTVTVRCGHCTNLLSVNMRSLLLPPAPANQ 39
                  8***********************998877644333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046903.8E-15138IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 65 aa     Download sequence    Send to blast
VSVPCSSLFK TVTVRCGHCT NLLSVNMRSL LLPPAPANQL HLGHSYFTPQ NLLVYCVRVP  60
CLLML
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010056343.13e-31PREDICTED: axial regulator YABBY 1-like
SwissprotO221526e-17YAB1_ARATH; Axial regulator YABBY 1
TrEMBLA0A059C4D48e-31A0A059C4D4_EUCGR; Uncharacterized protein
STRINGGLYMA01G33370.13e-24(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.14e-18YABBY family protein